PDB entry 2wyn

View 2wyn on RCSB PDB site
Description: structure of family 37 trehalase from escherichia coli in complex with a casuarine-6-o-a-d-glucoside analogue
Class: hydrolase
Keywords: hydrolase, glycosidase, glycoside hydrolase
Deposited on 2009-11-17, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16173
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyna_
  • Chain 'B':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wynb_
  • Chain 'C':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wync_
  • Chain 'D':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wynd_
  • Heterogens: LG9, GLC, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wynA (A:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wynA (A:)
    vtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqfdlrhfvnv
    nftlpkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyywd
    syftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvellaq
    hegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprpes
    wvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdlnsl
    mfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvrnq
    ltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqwva
    teglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggeyplqdgfgw
    tngvtlkmldlicpkeqpcdnvpatr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wynB (B:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wynB (B:)
    etpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlr
    hfvnvnftlpkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfre
    vyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmv
    ellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdt
    prpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpv
    dlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlksh
    kvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwap
    lqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttyplqdgfgwtng
    vtlkmldlicpkeqpcdnvpatr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wynC (C:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wynC (C:)
    qppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnvn
    ftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevy
    ywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvel
    laqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtpr
    peswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdl
    nslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkv
    rnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplq
    wvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttyplqdgfgwtngvt
    lkmldlicpkeqpcdnvpatr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wynD (D:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wynD (D:)
    tpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrh
    fvnvnftlpkkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfre
    vyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmv
    ellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdt
    prpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpv
    dlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlksh
    kvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwap
    lqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttyplqdgfgwtng
    vtlkmldlicpkeqpcdnvpatr