PDB entry 2wyf

View 2wyf on RCSB PDB site
Description: crystal structure of pa-il lectin complexed with agal12bgal-o-met at 2.4 a resolution
Class: sugar binding protein
Keywords: sugar binding protein, lectin
Deposited on 2009-11-16, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.1704
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyfa_
  • Chain 'B':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyfb_
  • Chain 'C':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyfc_
  • Chain 'D':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyfd_
  • Chain 'E':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyfe_
  • Chain 'F':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyff_
  • Chain 'G':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyfg_
  • Chain 'H':
    Compound: PA-I galactophilic lectin
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wyfh_
  • Heterogens: CA, GLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyfA (A:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wyfB (B:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wyfB (B:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvanvqgaitliyndvpgtygnnsgsfsvnigkdqs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyfC (C:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyfD (D:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyfE (E:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyfF (F:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyfG (G:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyfH (H:)
    awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
    fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
    s