PDB entry 2wy4

View 2wy4 on RCSB PDB site
Description: structure of bacterial globin from campylobacter jejuni at 1.35 a resolution
Class: oxygen transport
Keywords: heme, transport, oxygen transport
Deposited on 2009-11-11, released 2010-02-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.17997
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single domain haemoglobin
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2wy4a_
  • Heterogens: HEM, CYN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wy4A (A:)
    mtkeqiqiikdcvpilqkngedltnefykimfndypevkpmfnmekqisgeqpkalamai
    lmaaknienlenmrsfvdkvaithvnlgvkeehypivgacllkaiknllnpdeatlkawe
    vaygkiakfyidiekklydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wy4A (A:)
    tkeqiqiikdcvpilqkngedltnefykimfndypevkpmfnmekqisgeqpkalamail
    maaknienlenmrsfvdkvaithvnlgvkeehypivgacllkaiknllnpdeatlkawev
    aygkiakfyidiekklydk