PDB entry 2wxc

View 2wxc on RCSB PDB site
Description: The folding mechanism of BBL: Plasticity of transition-state structure observed within an ultrafast folding protein family.
Class: transferase
Keywords: lipoyl, transferase, acyltransferase
Deposited on 2009-11-06, released 2009-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrolipoyltranssuccinase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WXC (0-1)
    • engineered mutation (18)
  • Uniprot B7M5P0 (2-46)
  Domains in SCOPe 2.08: d2wxca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2wxcA (A:)
  gsqnndalspairrllaewnldasaikgtgvggrltredvekhlaka