PDB entry 2wxb

View 2wxb on RCSB PDB site
Description: acetylglutamate kinase from escherichia coli free of substrates
Class: transferase
Keywords: acetylglutamate kinase, aminoacid kinase family, kinase, arginine biosynthesis, transferase
Deposited on 2009-11-06, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wxba_
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wxbb_
  • Heterogens: DTU, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wxbA (A:)
    mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
    kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
    hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
    dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
    eqlpalfngmpmgtrila
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wxbA (A:)
    mnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvkk
    knglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelgh
    vglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlillsd
    vsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrhae
    qlpalfngmpmgtrila
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wxbB (B:)
    mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
    kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
    hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
    dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
    eqlpalfngmpmgtrila