PDB entry 2wx4

View 2wx4 on RCSB PDB site
Description: asymmetric trimer of the drosophila melanogaster dcp1 c-terminal domain
Deposited on 2009-11-01, released 2009-12-01
The last revision was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21725
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: decapping protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX4 (0-6)
    • Uniprot Q9W1H5 (7-End)
  • Chain 'B':
    Compound: decapping protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX4 (Start-6)
    • Uniprot Q9W1H5 (7-45)
  • Chain 'C':
    Compound: decapping protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX4 (0-6)
    • Uniprot Q9W1H5 (7-End)
  • Chain 'D':
    Compound: decapping protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX4 (0-6)
    • Uniprot Q9W1H5 (7-End)
  • Chain 'E':
    Compound: decapping protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX4 (Start-6)
    • Uniprot Q9W1H5 (7-End)
  • Chain 'F':
    Compound: decapping protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX4 (Start-6)
    • Uniprot Q9W1H5 (7-45)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wx4A (A:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnllld

    Sequence, based on observed residues (ATOM records):
    >2wx4A (A:)
gphmadlllnstqfvqaftyliqndkefanklhkayln

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2wx4B (B:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnllld

    Sequence, based on observed residues (ATOM records):
    >2wx4B (B:)
dlllnstqfvqaftyliqndkefanklhkaylngcsnllld

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2wx4C (C:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnllld

    Sequence, based on observed residues (ATOM records):
    >2wx4C (C:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnl

  • Chain 'D':
    Sequence, based on SEQRES records:
    >2wx4D (D:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnllld

    Sequence, based on observed residues (ATOM records):
    >2wx4D (D:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnlll

  • Chain 'E':
    Sequence, based on SEQRES records:
    >2wx4E (E:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnllld

    Sequence, based on observed residues (ATOM records):
    >2wx4E (E:)
hmadlllnstqfvqaftyliqndkefanklhkaylngcsnlll

  • Chain 'F':
    Sequence, based on SEQRES records:
    >2wx4F (F:)
gphmadlllnstqfvqaftyliqndkefanklhkaylngcsnllld

    Sequence, based on observed residues (ATOM records):
    >2wx4F (F:)
phmadlllnstqfvqaftyliqndkefanklhkaylngcsnllld