PDB entry 2wx3

View 2wx3 on RCSB PDB site
Description: asymmetric trimer of the human dcp1a c-terminal domain
Deposited on 2009-11-01, released 2009-12-01
The last revision was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.21007
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA-decapping enzyme 1a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX3 (0-6)
    • Uniprot Q9NPI6 (7-End)
  • Chain 'B':
    Compound: mRNA-decapping enzyme 1a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX3 (Start-6)
    • Uniprot Q9NPI6 (7-End)
  • Chain 'C':
    Compound: mRNA-decapping enzyme 1a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WX3 (Start-6)
    • Uniprot Q9NPI6 (7-50)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wx3A (A:)
    gphmadlsiilsksqlqdtlihlikndssflstlhevylqvltknkdnhnl
    

    Sequence, based on observed residues (ATOM records):
    >2wx3A (A:)
    gphmadlsiilsksqlqdtlihlikndssflstlhevylqvlt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2wx3B (B:)
    gphmadlsiilsksqlqdtlihlikndssflstlhevylqvltknkdnhnl
    

    Sequence, based on observed residues (ATOM records):
    >2wx3B (B:)
    madlsiilsksqlqdtlihlikndssflstlhevylqvltkn
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2wx3C (C:)
    gphmadlsiilsksqlqdtlihlikndssflstlhevylqvltknkdnhnl
    

    Sequence, based on observed residues (ATOM records):
    >2wx3C (C:)
    adlsiilsksqlqdtlihlikndssflstlhevylqvltknkdnhnl