PDB entry 2www

View 2www on RCSB PDB site
Description: Crystal Structure of Methylmalonic Acidemia Type A Protein
Class: transport protein
Keywords: transport protein, nucleotide-binding
Deposited on 2009-10-30, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.184
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylmalonic aciduria type a protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wwwa_
  • Chain 'B':
    Compound: methylmalonic aciduria type a protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wwwb_
  • Chain 'C':
    Compound: methylmalonic aciduria type a protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wwwc_
  • Chain 'D':
    Compound: methylmalonic aciduria type a protein, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wwwd_
  • Heterogens: 2PE, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wwwA (A:)
    smkdhteglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvlly
    hreqeqsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdpssctsggs
    llgdktrmtelsrdmnayirpsptrgtlggvtrttneaillcegagydiilietvgvgqs
    efavadmvdmfvlllppaggdelqgikrgiiemadlvavtksdgdlivparriqaeyvsa
    lkllrkrsqvwkpkvirisarsgegisemwdkmkdfqdlmlasgeltakrrkqqkvwmwn
    liqesvlehfrthptvreqiplleqkvligalspglaadfllkafksrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wwwA (A:)
    teglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvllyhreqe
    qsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdptelsrdmnayirp
    strttneaillcegagydiilietvgvsefavadmvdmfvlllppaiemadlvavtksdg
    dlivparriqaeyvsalkllrwkpkvirisarsgegisemwdkmkdfqdlmlasgeltak
    rrkqqkvwmwnliqesvlehfrthptvreqiplleqkvligalspglaadfllkafks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wwwB (B:)
    smkdhteglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvlly
    hreqeqsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdpssctsggs
    llgdktrmtelsrdmnayirpsptrgtlggvtrttneaillcegagydiilietvgvgqs
    efavadmvdmfvlllppaggdelqgikrgiiemadlvavtksdgdlivparriqaeyvsa
    lkllrkrsqvwkpkvirisarsgegisemwdkmkdfqdlmlasgeltakrrkqqkvwmwn
    liqesvlehfrthptvreqiplleqkvligalspglaadfllkafksrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wwwB (B:)
    glsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvllyhreqeqs
    nkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdtelsrdmnayirptrt
    tneaillcegagydiilietvgqsefavadmvdmfvlllppiiemadlvavtksdgdliv
    parriqaeyvsalkllrkrsqvwkpkvirisarsgegisemwdkmkdfqdlmlasgelta
    krrkqqkvwmwnliqesvlehfrthptvreqiplleqkvligalspglaadfllkafks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wwwC (C:)
    smkdhteglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvlly
    hreqeqsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdpssctsggs
    llgdktrmtelsrdmnayirpsptrgtlggvtrttneaillcegagydiilietvgvgqs
    efavadmvdmfvlllppaggdelqgikrgiiemadlvavtksdgdlivparriqaeyvsa
    lkllrkrsqvwkpkvirisarsgegisemwdkmkdfqdlmlasgeltakrrkqqkvwmwn
    liqesvlehfrthptvreqiplleqkvligalspglaadfllkafksrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wwwC (C:)
    rfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvllyhreqeqsnkgkpla
    frvglsgppgagkstfieyfgkmlterghklsvlavdpstelsrdmnayirvtrttneai
    llcegagydiilietvgvgqsefavadmvdmfvlllppaiemadlvavtksdgdlivpar
    riqaeyvsalkllrkwkpkvirisarsgegisemwdkmkdfqdlmlasgeltakrrkqqk
    vwmwnliqesvlehfrthptvreqiplleqkvligalspglaadfllkafks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wwwD (D:)
    smkdhteglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvlly
    hreqeqsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdpssctsggs
    llgdktrmtelsrdmnayirpsptrgtlggvtrttneaillcegagydiilietvgvgqs
    efavadmvdmfvlllppaggdelqgikrgiiemadlvavtksdgdlivparriqaeyvsa
    lkllrkrsqvwkpkvirisarsgegisemwdkmkdfqdlmlasgeltakrrkqqkvwmwn
    liqesvlehfrthptvreqiplleqkvligalspglaadfllkafksrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wwwD (D:)
    dhteglsdkeqrfvdklytgliqgqraclaeaitlvesthsrkkelaqvllqkvllyhre
    qeqsnkgkplafrvglsgppgagkstfieyfgkmlterghklsvlavdpstelsrdmnay
    irpsptrttneaillcegagydiilietvgvgqsefavadmvdmfvlllppaikrgiiem
    adlvavtksdgdlivparriqaeyvsalkllrkrsqvwkpkvirisarsgegisemwdkm
    kdfqdlmlasgeltakrrkqqkvwmwnliqesvlehfrthptvreqiplleqkvligals
    pglaadfllkafks