PDB entry 2wwv
View 2wwv on RCSB PDB site
Description: nmr structure of the iiachitobiose-iibchitobiose complex of the n,n'- diacetylchitoboise brance of the e. coli phosphotransferase system.
Deposited on
2009-10-29, released
2009-12-08
The last revision was dated
2019-10-16, with a file datestamp of
2019-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P69791 (0-102)
- engineered mutation (75)
- engineered mutation (78)
- Chain 'B':
Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P69791 (0-102)
- engineered mutation (75)
- engineered mutation (78)
- Chain 'C':
Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P69791 (0-102)
- engineered mutation (75)
- engineered mutation (78)
- Chain 'D':
Compound: n,n'-diacetylchitobiose-specific phosphotransferase enzyme iib component
Species: Escherichia coli K-12 [TaxId:83333]
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence; same for both SEQRES and ATOM records:
>2wwvA (A:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka
- Chain 'B':
Sequence; same for both SEQRES and ATOM records:
>2wwvB (B:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka
- Chain 'C':
Sequence; same for both SEQRES and ATOM records:
>2wwvC (C:)
aeeleevvmgliinsgqarslayaalkqakqgdfaaakammdqsrmalneahlvqtklie
gdagegkmkvslvlveaqlhlmtsmlarelitelielheklka
- Chain 'D':
Sequence; same for both SEQRES and ATOM records:
>2wwvD (D:)
kkhiylfssagmstsllvskmraqaekyevpviieafpetlagekgqnadvvllgpqiay
mlpeiqrllpnkpvevidsllygkvdglgvlkaavaaikkaaa