PDB entry 2wwm

View 2wwm on RCSB PDB site
Description: crystal structure of the titin m10-obscurin like 1 ig complex in space group p1
Class: transferase/structural protein
Keywords: transferase-structural protein complex, sarcomere, tpr repeat, immunoglobulin domain, limb-girdle muscular dystrophy, serine/threonine-protein kinase, transferase, cardiomyopathy, calmodulin-binding, nucleotide-binding
Deposited on 2009-10-26, released 2010-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19997
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Obscurin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WWM
    • Uniprot O75147 (Start-108)
  • Chain 'D':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WWM (Start-2)
    • Uniprot Q8WZ42 (3-101)
    Domains in SCOPe 2.05: d2wwmd_
  • Chain 'O':
    Compound: Obscurin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WWM (Start-2)
    • Uniprot Q8WZ42 (3-End)
    Domains in SCOPe 2.05: d2wwmt_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wwmD (D:)
    gssrgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhien
    tddlttliimdvqkqdgglytlslgnefgsdsatvnihirsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wwmD (D:)
    srgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientd
    dlttliimdvqkqdgglytlslgnefgsdsatvnihirsi
    

  • Chain 'O':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2wwmT (T:)
    gssrgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhien
    tddlttliimdvqkqdgglytlslgnefgsdsatvnihirsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wwmT (T:)
    srgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientd
    dlttliimdvqkqdgglytlslgnefgsdsatvnihir