PDB entry 2wvj

View 2wvj on RCSB PDB site
Description: Mutation of Thr163 to Ser in Human Thymidine Kinase Shifts the Specificity from Thymidine towards the Nucleoside Analogue Azidothymidine
Class: transferase
Keywords: zinc-binding domain, deoxyribonucleoside kinase, feedback inhibitor, nucleotide-binding, kinase, transferase, ATP-binding, DNA synthesis, phosphoprotein, phosphorylation
Deposited on 2009-10-17, released 2009-10-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvja1, d2wvja2
  • Chain 'B':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvjb1, d2wvjb2
  • Chain 'C':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvjc1, d2wvjc2
  • Chain 'D':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvjd1, d2wvjd2
  • Chain 'E':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvje1, d2wvje2
  • Chain 'F':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvjf1, d2wvjf2
  • Chain 'G':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvjg1, d2wvjg2
  • Chain 'H':
    Compound: Thymidine kinase, cytosolic
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04183
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2wvjh1, d2wvjh2
  • Heterogens: TTP, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wvjA (A:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjA (A:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wvjB (B:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjB (B:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaayskrlgtekeveviggadkyhsvcrlcyfkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wvjC (C:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjC (C:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wvjD (D:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjD (D:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysalpacllrdvaqeal
    gvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvkl
    tavcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wvjE (E:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjE (E:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wvjF (F:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjF (F:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
    avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklta
    vcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2wvjG (G:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjG (G:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtryalpacllrdvaqealg
    vavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt
    avcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2wvjH (H:)
    mscinlptvlpgspsktrgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtr
    ysssfcthdrntmealpacllrdvaqealgvavigidegqffpdivefceamanagktvi
    vaaldgtfqrkpfgailnlvplaesvvkltavcmecfreaayskrlgtekeveviggadk
    yhsvcrlcyfkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvjH (H:)
    rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssmealpacllrdva
    qealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaes
    vvkltavcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk