PDB entry 2wvg

View 2wvg on RCSB PDB site
Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis
Class: lyase
Keywords: thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation
Deposited on 2009-10-16, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.158
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvga1, d2wvga2, d2wvga3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvgb1, d2wvgb2, d2wvgb3
  • Chain 'E':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvge1, d2wvge2, d2wvge3
  • Chain 'F':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvgf1, d2wvgf2, d2wvgf3
  • Heterogens: F, TPU, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wvgA (A:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvgA (A:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wvgB (B:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvgB (B:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wvgE (E:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvgE (E:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wvgF (F:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvgF (F:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk