PDB entry 2wv7

View 2wv7 on RCSB PDB site
Description: Intracellular subtilisin precursor from B. clausii
Class: hydrolase
Keywords: hydrolase, intracellular proteinase regulation
Deposited on 2009-10-15, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.202
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intracellular subtilisin protease
    Species: BACILLUS CLAUSII [TaxId:79880]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wv7a_
  • Chain 'B':
    Compound: intracellular subtilisin protease
    Species: BACILLUS CLAUSII [TaxId:79880]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wv7b_
  • Chain 'C':
    Compound: intracellular subtilisin protease
    Species: BACILLUS CLAUSII [TaxId:79880]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wv7c_
  • Chain 'D':
    Compound: intracellular subtilisin protease
    Species: BACILLUS CLAUSII [TaxId:79880]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wv7d_
  • Chain 'E':
    Compound: intracellular subtilisin protease
    Species: BACILLUS CLAUSII [TaxId:79880]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wv7e_
  • Chain 'F':
    Compound: intracellular subtilisin protease
    Species: BACILLUS CLAUSII [TaxId:79880]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wv7f_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wv7A (A:)
    mrkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdla
    eriiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsg
    dgsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvca
    agnegdgredtnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstyld
    sgyaelsgtamaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegn
    gfltldlveritgqftekgkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv7A (A:)
    kfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlaer
    iiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgdg
    sgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaag
    nnefaypaayneviavgavdfdlrleidivapgvgikstyldsgyaelsgtamaaphvag
    alaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wv7B (B:)
    mrkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdla
    eriiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsg
    dgsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvca
    agnegdgredtnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstyld
    sgyaelsgtamaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegn
    gfltldlveritgqftekgkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv7B (B:)
    kfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlaer
    iiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgdg
    sgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaag
    nnefaypaayneviavgavdfdlrleidivapgvgikstyldsgyaelsgtamaaphvag
    alaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wv7C (C:)
    mrkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdla
    eriiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsg
    dgsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvca
    agnegdgredtnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstyld
    sgyaelsgtamaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegn
    gfltldlveritgqftekgkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv7C (C:)
    kfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlaer
    iiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgdg
    sgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaag
    nnefaypaayneviavgavdfdlrleidivapgvgikstyldsgyaelsgtamaaphvag
    alaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqft
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wv7D (D:)
    mrkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdla
    eriiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsg
    dgsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvca
    agnegdgredtnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstyld
    sgyaelsgtamaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegn
    gfltldlveritgqftekgkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv7D (D:)
    kfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlaer
    iiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgdg
    sgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaag
    nnefaypaayneviavgavdfdlrleidivapgvgikstyldsgyaelsgtamaaphvag
    alaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqft
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wv7E (E:)
    mrkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdla
    eriiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsg
    dgsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvca
    agnegdgredtnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstyld
    sgyaelsgtamaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegn
    gfltldlveritgqftekgkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv7E (E:)
    kfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlaer
    iiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgdg
    sgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaag
    nnefaypaayneviavgavdfdlrleidivapgvgikstyldsgyaelsgtamaaphvag
    alaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqft
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wv7F (F:)
    mrkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdla
    eriiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsg
    dgsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvca
    agnegdgredtnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstyld
    sgyaelsgtamaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegn
    gfltldlveritgqftekgkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv7F (F:)
    mrkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdla
    eriiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsg
    dgsgemgwiakairyavdwrqmriitmslggptdseelhdavkyavsnnvsvvcaagnne
    faypaayneviavgavdfdlrleidivapgvgikstyldsgyaelsgtamaaphvagala
    liinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlveritgqft