PDB entry 2wv1

View 2wv1 on RCSB PDB site
Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by a linker containing two thrombin sites
Class: transcription
Keywords: transcription, transcription regulation, tetr family
Deposited on 2009-10-12, released 2009-10-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18951
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemolysin II regulatory protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X506 (187-End)
      • linker (170)
      • linker (172-173)
      • linker (184-186)
    Domains in SCOPe 2.04: d2wv1a1, d2wv1a2
  • Chain 'B':
    Compound: hemolysin II regulatory protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X506 (187-End)
      • linker (170)
      • linker (172-173)
      • linker (185-186)
    Domains in SCOPe 2.04: d2wv1b1, d2wv1b2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wv1A (A:)
    gshmasreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyev
    fkkyglanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarleki
    kpyfigsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidglvprgsggl
    vprgsgdlvsriisaltdkpni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv1A (A:)
    sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
    lanlpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfig
    sfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidglvpsgdlvsriisal
    tdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wv1B (B:)
    gshmasreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyev
    fkkyglanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarleki
    kpyfigsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidglvprgsggl
    vprgsgdlvsriisaltdkpni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wv1B (B:)
    sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
    lanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfi
    gsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidglvpgdlvsriisal
    tdk