PDB entry 2wut

View 2wut on RCSB PDB site
Description: crystal structure of human myelin protein p2 in complex with palmitate
Class: transport
Keywords: myelin, transport, lipid-binding, fatty acid binding protein, peripheral membrane protein
Deposited on 2009-10-09, released 2010-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.1685
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myelin p2 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUT (0-0)
    • Uniprot P02689 (1-132)
    Domains in SCOPe 2.08: d2wuta1, d2wuta2
  • Heterogens: PLM, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wutA (A:)
gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestfk
nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
mkgvvctriyekv