PDB entry 2wuh

View 2wuh on RCSB PDB site
Description: crystal structure of the ddr2 discoidin domain bound to a triple-helical collagen peptide
Class: receptor/peptide
Keywords: receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase
Deposited on 2009-10-05, released 2009-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2019
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: discoidin domain receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUH
    • Uniprot Q16832 (13-End)
    Domains in SCOPe 2.08: d2wuha_
  • Chain 'B':
    Compound: collagen peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUH (Start-27)
  • Chain 'C':
    Compound: collagen peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUH (Start-27)
  • Chain 'D':
    Compound: collagen peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUH
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wuhA (A:)
    aplvhhhhhhalanpaicryplgmsggqipdeditassqwsestaakygrldseegdgaw
    cpeipvepddlkeflqidlhtlhfitlvgtqgrhagghgiefapmykinysrdgtrwisw
    rnrhgkqvldgnsnpydiflkdleppivarfvrfipvtdhsmnvcmrvelygcvwldg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wuhA (A:)
    npaicryplgmsggqipdeditassqwsestaakygrldseegdgawcpeipvepddlke
    flqidlhtlhfitlvgtqgrhagghgiefapmykinysrdgtrwiswrnrhgkqvldgns
    npydiflkdleppivarfvrfipvtdhsmnvcmrvelygcvwld
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.