PDB entry 2wuc

View 2wuc on RCSB PDB site
Description: Crystal structure of HGFA in complex with the allosteric non- inhibitory antibody Fab40.deltaTrp and Ac-KQLR-chloromethylketone
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, egf-like domain, allosteric inhibitor, kringle, antibody, hydrolase, fab complex, glycoprotein, immune system, hydrolase-hydrolase inhibitor complex
Deposited on 2009-10-01, released 2009-12-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor activator long chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04756 (0-End)
    • PDB 2WUC
  • Chain 'B':
    Compound: Hepatocyte growth factor activator short chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: fab fragment fab40.deltatrp heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUC (0-End)
  • Chain 'I':
    Compound: ace-kqlr-chloromethylketone inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUC (Start-4)
  • Chain 'L':
    Compound: fab fragment fab40.deltatrp light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUC (0-213)
    Domains in SCOPe 2.03: d2wucl1, d2wucl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wucL (L:)
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsnrapatfgqgtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec