PDB entry 2wub

View 2wub on RCSB PDB site
Description: Crystal structure of HGFA in complex with the allosteric non- inhibitory antibody Fab40.deltaTrp
Class: hydrolase/immune system
Keywords: HYDROLASE IMMUNE SYSTEM COMPLEX, DISULFIDE BOND, SERINE PROTEASE, EGF-LIKE DOMAIN, ALLOSTERIC INHIBITOR, KRINGLE, ZYMOGEN, PROTEASE, SECRETED, ANTIBODY, HYDROLASE, FAB COMPLEX, GLYCOPROTEIN, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2009-10-01, released 2009-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor activator long chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04756 (0-End)
    • PDB 2WUB
  • Chain 'B':
    Compound: Hepatocyte growth factor activator short chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hepatocyte growth factor activator long chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04756 (0-End)
    • PDB 2WUB
  • Chain 'D':
    Compound: Hepatocyte growth factor activator short chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: fab fragment fab40.deltatrp heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUB (0-End)
  • Chain 'L':
    Compound: fab fragment fab40.deltatrp light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUB (0-213)
    Domains in SCOPe 2.04: d2wubl1, d2wubl2
  • Chain 'Q':
    Compound: fab fragment fab40.deltatrp light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUB (0-213)
    Domains in SCOPe 2.04: d2wubq1, d2wubq2
  • Chain 'R':
    Compound: fab fragment fab40.deltatrp heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WUB (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wubL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsnrapatfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wubQ (Q:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsnrapatfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'R':
    No sequence available.