PDB entry 2wty

View 2wty on RCSB PDB site
Description: Crystal structure of the homodimeric MafB in complex with the T-MARE binding site
Deposited on 2009-09-25, released 2010-12-08
The last revision was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor mafb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54841
      • engineered mutation (88)
  • Chain 'B':
    Compound: transcription factor mafb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54841 (1-96)
      • expression tag (0)
      • engineered mutation (88)
      • engineered mutation (96)
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*ap*tp*tp*gp*cp*tp*gp*ap*cp*tp*cp*ap *gp*cp*ap*ap*ap*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*tp*tp*gp*cp*tp*gp*ap*gp*tp*cp*ap *gp*cp*ap*ap*tp*t)-3')
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wtyA (A:)
mfsddqlvsmsvrelnrhlrgftkdevirlkqkrrtlknrgyaqscrykrvqqkhhlene
ktqliqqveqlkqevsrlarerdaykvkseklansgr

    Sequence, based on observed residues (ATOM records):
    >2wtyA (A:)
sddqlvsmsvrelnrhlrgftkdevirlkqkrrtlknrgyaqscrykrvqqkhhlenekt
qliqqveqlkqevsrlarerdaykvkseklansg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2wtyB (B:)
mfsddqlvsmsvrelnrhlrgftkdevirlkqkrrtlknrgyaqscrykrvqqkhhlene
ktqliqqveqlkqevsrlarerdaykvkseklansgr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.