PDB entry 2wtv

View 2wtv on RCSB PDB site
Description: aurora-a inhibitor structure
Class: transferase
Keywords: kinase, cell cycle, transferase, phosphoprotein
Deposited on 2009-09-22, released 2010-01-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.167
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6 aurora/ipl1-related kinase 1, breast tumor-amplified kinase, aurora-a, aurora-related kinase 1, hark1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTV
      • engineered mutation (96)
      • engineered mutation (98)
      • engineered mutation (101)
    • Uniprot O14965
    Domains in SCOPe 2.04: d2wtva_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 6 aurora/ipl1-related kinase 1, breast tumor-amplified kinase, aurora-a, aurora-related kinase 1, hark1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTV
      • engineered mutation (96)
      • engineered mutation (98)
      • engineered mutation (101)
    • Uniprot O14965
    Domains in SCOPe 2.04: d2wtvb_
  • Chain 'C':
    Compound: serine/threonine-protein kinase 6 aurora/ipl1-related kinase 1, breast tumor-amplified kinase, aurora-a, aurora-related kinase 1, hark1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTV
      • engineered mutation (96)
      • engineered mutation (98)
      • engineered mutation (101)
    • Uniprot O14965
    Domains in SCOPe 2.04: d2wtvc_
  • Chain 'D':
    Compound: serine/threonine-protein kinase 6 aurora/ipl1-related kinase 1, breast tumor-amplified kinase, aurora-a, aurora-related kinase 1, hark1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTV
      • engineered mutation (96)
      • engineered mutation (98)
      • engineered mutation (101)
    • Uniprot O14965
    Domains in SCOPe 2.04: d2wtvd_
  • Heterogens: ZZL, EDO, ACT, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wtvA (A:)
    gameskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtvA (A:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitanssk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wtvB (B:)
    gameskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtvB (B:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
    hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
    hnpsqrpmlrevlehpwitanssk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wtvC (C:)
    gameskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtvC (C:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
    hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
    hnpsqrpmlrevlehpwitanssk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wtvD (D:)
    gameskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtvD (D:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitanssk