PDB entry 2wtk

View 2wtk on RCSB PDB site
Description: structure of the heterotrimeric lkb1-stradalpha-mo25alpha complex
Class: transferase/metal-binding protein
Keywords: transferase-metal-binding protein complex, transferase metal-binding protein complex, kinase, nucleus, serine/threonine-protein kinase, pseudokinase, phosphoprotein, signal transduction, transferase, nucleotide-binding
Deposited on 2009-09-16, released 2009-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.24
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium-binding protein 39
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wtka_
  • Chain 'B':
    Compound: ste20-related kinase adapter protein alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: serine/threonine-protein kinase 11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15831
      • engineered mutation (151)
    Domains in SCOPe 2.06: d2wtkc1
  • Chain 'D':
    Compound: calcium-binding protein 39
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wtkd_
  • Chain 'E':
    Compound: ste20-related kinase adapter protein alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: serine/threonine-protein kinase 11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15831
      • engineered mutation (151)
    Domains in SCOPe 2.06: d2wtkf1
  • Heterogens: ANP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wtkA (A:)
    mpfpfgkshkspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnek
    epqteavaqlaqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyi
    ctqqnilfmllkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdi
    asdafatfkdlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldr
    hnftimtkyiskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqa
    klieflskfqndrtedeqfndektylvkqirdlkrpaqqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtkA (A:)
    hkspadivknlkesmavlekqisdkkaekateevsknlvamkeilynekepqteavaqla
    qelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmll
    kgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdl
    ltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyis
    kpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqn
    drqfndektylvkqirdlkrp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wtkC (C:)
    akligkylmgdllgegsygkvkevldsetlcrravkilkkkklrripngeanvkkeiqll
    rrlrhknviqlvdvlyneekqkmymvmeycvcgmqemldsvpekrfpvcqahgyfcqlid
    gleylhsqgivhkdikpgnlllttggtlkisalgvaealhpfaaddtcrtsqgspafqpp
    eiangldtfsgfkvdiwsagvtlynittglypfegdniyklfenigkgsyaipgdcgppl
    sdllkgmleyepakrfsirqirqhswfrkkhppaeapvpippspdtkdrwrsmtvvpyle
    dlhga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtkC (C:)
    gkylmgdllgegsygkvkevldsetlcrravkilkkkklrripngeanvkkeiqllrrlr
    hknviqlvdvlynekmymvmeycvcgmqemldsvpekrfpvcqahgyfcqlidgleylhs
    qgivhkdikpgnlllttggtlkisalgvaealhpfaaddtcrtsqgspafqppeiangld
    tfsgfkvdiwsagvtlynittglypfegdniyklfenigkgsyaipgdcgpplsdllkgm
    leyepakrfsirqirqhswfrkkhppeapvpippsdrwtvvpyle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wtkD (D:)
    mpfpfgkshkspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnek
    epqteavaqlaqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyi
    ctqqnilfmllkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdi
    asdafatfkdlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldr
    hnftimtkyiskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqa
    klieflskfqndrtedeqfndektylvkqirdlkrpaqqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtkD (D:)
    kspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnkepqteavaql
    aqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfml
    lkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkd
    lltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyi
    skpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfq
    ndredeqfndektylvkqirdlkrp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wtkF (F:)
    akligkylmgdllgegsygkvkevldsetlcrravkilkkkklrripngeanvkkeiqll
    rrlrhknviqlvdvlyneekqkmymvmeycvcgmqemldsvpekrfpvcqahgyfcqlid
    gleylhsqgivhkdikpgnlllttggtlkisalgvaealhpfaaddtcrtsqgspafqpp
    eiangldtfsgfkvdiwsagvtlynittglypfegdniyklfenigkgsyaipgdcgppl
    sdllkgmleyepakrfsirqirqhswfrkkhppaeapvpippspdtkdrwrsmtvvpyle
    dlhga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtkF (F:)
    ligkylmgdllgegsygkvkevldsetlcrravkilkkkklrripngeanvkkeiqllrr
    lrhknviqlvdvlynmymvmeycvcgmqemldsvpekrfpvcqahgyfcqlidgleylhs
    qgivhkdikpgnlllttggtlkisalgvaealhpfaaddtcrtsqgspafqppeiangld
    tfsgfkvdiwsagvtlynittglypfegklfenigkgaipglsdllkgmleyepakrfsi
    rqirqhswfrkkhppeapvpipptvvpy