PDB entry 2wt7

View 2wt7 on RCSB PDB site
Description: crystal structure of the bzip heterodimeric complex mafb:cfos bound to dna
Deposited on 2009-09-11, released 2010-09-29
The last revision was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene protein c-fos
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: transcription factor mafb
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54841 (0-89)
      • engineered mutation (84)
  • Chain 'C':
    Compound: modified t-mare motif
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: modified t-mare motif
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wt7A (A:)
ekrrirrernkmaaakcrnrrreltdtlqaetdqledeksalqteianllkekeklefil
aah

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2wt7B (B:)
dqlvsmsvrelnrhlrgftkdevirlkqkrrtlknrgyaqscrykrvqqkhhlenektql
iqqveqlkqevsrlarerdaykvkseklan

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.