PDB entry 2wsr

View 2wsr on RCSB PDB site
Description: monotim mutant rmm0-1, monomeric form.
Class: isomerase
Keywords: temperature dependant equilibrium, catalysis, isomerase, glycosome, glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis
Deposited on 2009-09-08, released 2009-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triose phosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (75-241)
      • engineered mutation (41-42)
      • engineered mutation (45-46)
      • engineered mutation (177)
    • PDB 2WSR (66-74)
    Domains in SCOPe 2.08: d2wsra_
  • Heterogens: SO4, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wsrA (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvaprfvmiamtkerlshpkfv
    iaaqnagnadglaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqetha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq