PDB entry 2wsq

View 2wsq on RCSB PDB site
Description: monotim mutant rmm0-1, dimeric form.
Class: isomerase
Keywords: temperature dependant equilibrium, catalysis, isomerase, glycosome, glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis
Deposited on 2009-09-08, released 2009-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.20813
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triose phosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (75-241)
      • engineered mutation (41-42)
      • engineered mutation (177)
    • PDB 2WSQ (66-74)
    Domains in SCOPe 2.07: d2wsqa_
  • Chain 'B':
    Compound: triose phosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (75-241)
      • engineered mutation (41-42)
      • engineered mutation (177)
    • PDB 2WSQ (66-74)
    Domains in SCOPe 2.07: d2wsqb_
  • Chain 'C':
    Compound: triose phosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (75-241)
      • engineered mutation (41-42)
      • engineered mutation (177)
    • PDB 2WSQ (66-74)
    Domains in SCOPe 2.07: d2wsqc_
  • Chain 'D':
    Compound: triose phosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (75-241)
      • engineered mutation (41-42)
      • engineered mutation (177)
    • PDB 2WSQ (66-74)
    Domains in SCOPe 2.07: d2wsqd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wsqA (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapsfvhlamtkerlshpkfv
    iaaqnagnadglaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqetha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wsqB (B:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapsfvhlamtkerlshpkfv
    iaaqnagnadglaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqetha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wsqC (C:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapsfvhlamtkerlshpkfv
    iaaqnagnadglaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqetha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wsqD (D:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvapsfvhlamtkerlshpkfv
    iaaqnagnadglaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqetha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq