PDB entry 2wsp

View 2wsp on RCSB PDB site
Description: thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, carbohydrate synthesis, thermophilic enzyme
Deposited on 2009-09-08, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.20338
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-L-fucosidase, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYE2
      • engineered mutation (223)
    Domains in SCOPe 2.07: d2wspa1, d2wspa2
  • Chain 'B':
    Compound: Alpha-L-fucosidase, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYE2
      • engineered mutation (223)
    Domains in SCOPe 2.07: d2wspb1, d2wspb2
  • Heterogens: FUC, FUY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wspA (A:)
    mismkprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawff
    qnpyaewyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagak
    yvipttkhhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrf
    ttepirypedlsyirpntyeyadyaykqvmelvdlylpdvlwngmgwpekgkedlkylfa
    yyynkhpegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpeh
    mlsveqlvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiygtsv
    werccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltgerlsfk
    nvgknleitvpkklletdsitlvleavee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wspA (A:)
    kprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgvpmdawffqnpya
    ewyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyvipt
    tkhhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepi
    rypedlsyirpntyeyadyaykqvmelvdlylpdvlwngmgwpekgkedlkylfayyynk
    hpegsvndrwgvphwdfktaeylpgykweftrgiglsfgynrnegpehmlsveqlvytlv
    dvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiygtsvwerccaktedgt
    eirftrkcnrifviflgiptgekiviedlnlsagtvrhfltgerlsfknvgknleitvpk
    klletdsitlvleav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wspB (B:)
    mismkprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawff
    qnpyaewyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagak
    yvipttkhhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrf
    ttepirypedlsyirpntyeyadyaykqvmelvdlylpdvlwngmgwpekgkedlkylfa
    yyynkhpegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpeh
    mlsveqlvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiygtsv
    werccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltgerlsfk
    nvgknleitvpkklletdsitlvleavee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wspB (B:)
    kprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelvpmdawffqnpyae
    wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
    khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
    ypedlsyirpntyeyadyaykqvmelvdlylpdvlwngmgwpekgkedlkylfayyynkh
    pegsvndrwgvphwdfktaeylpgykweftrgiglsfgynrnegpehmlsveqlvytlvd
    vvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiygtsvwerccaktedgte
    irftrkcnrifviflgiptgekiviedlnlsagtvrhfltgerlsfknvgknleitvpkk
    lletdsitlvleav