PDB entry 2ws9

View 2ws9 on RCSB PDB site
Description: equine rhinitis a virus at low ph
Class: virus
Keywords: virus, capsid, picornavirus
Deposited on 2009-09-04, released 2010-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.275
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: p1
    Species: EQUINE RHINITIS A VIRUS [TaxId:47000]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: p1
    Species: EQUINE RHINITIS A VIRUS [TaxId:47000]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9VV85 (Start-229)
      • conflict (84)
  • Chain '3':
    Compound: p1
    Species: EQUINE RHINITIS A VIRUS [TaxId:47000]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9VV85 (0-225)
      • conflict (58)
    Domains in SCOPe 2.06: d2ws93_
  • Chain '4':
    Compound: p1
    Species: EQUINE RHINITIS A VIRUS [TaxId:47000]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ws93 (3:)
    apirvvsvpesdsfmssvpdnstplypkvvvpprqvpgrftnfidvakqtysfcsisgkp
    yfevtntsgdeplfqmdvslsaaelhgtyvaslssffaqyrgslnfnfiftgaaatkakf
    lvafvpphsaapktrdeamacihavwdvglnsafsfnvpysspadfmavysaeatvvnvs
    gwlqvyaltaltstdiavnskgrvlvavsagpdfslrhpvdlpdkq
    

  • Chain '4':
    No sequence available.