SCOPe 2.05: Structural Classification of Proteins

PDB entry 2wrt

View 2wrt on RCSB PDB site
Description: the 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26
Class: transferase
Keywords: parasite, trematode, transferase
Deposited on 2009-09-02, released 2010-09-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.20926
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrta1, d2wrta2
Chain 'B':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtb1, d2wrtb2
Chain 'C':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtc1, d2wrtc2
Chain 'D':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtd1, d2wrtd2
Chain 'E':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrte1, d2wrte2
Chain 'F':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtf1, d2wrtf2
Chain 'G':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtg1, d2wrtg2
Chain 'H':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrth1, d2wrth2
Chain 'I':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrti1, d2wrti2
Chain 'J':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtj1, d2wrtj2
Chain 'K':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtk1, d2wrtk2
Chain 'L':
Compound: glutathione s-transferase class-mu 26 kda isozyme 51
Species: Fasciola hepatica [TaxId:6192]
Database cross-references and differences (RAF-indexed):
- Uniprot P30112 (Start-217)
  - conflict (41)
  - conflict (83)
  - conflict (146)
Domains in SCOPe 2.05: d2wrtl1, d2wrtl2
Heterogens: CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2wrtA (A:)
mpaklgywkirglqqpvrllleylgeeyeehlygrddrekwlgdkfnmgldlpnlpyyid
dkckltqsvaimryiadkhgmlgstpeerarismiegaamdlrmgfvrvcynpkfeevkg
dylkelpttlkmwsnflgdrhyltgssvshvdfmvyealdcirylapqcledfpklkefk
sriedlpkikaymesekfikwplnswiasfgggdaapa