PDB entry 2wrf

View 2wrf on RCSB PDB site
Description: structure of h2 avian jena hemagglutinin with human receptor
Class: viral protein
Keywords: viral protein, glycoprotein, lipoprotein, envelope protein
Deposited on 2009-09-01, released 2009-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2765
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfa1, d2wrfa2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfb1, d2wrfb2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfc1, d2wrfc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfd1, d2wrfd2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfe1, d2wrfe2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrff1, d2wrff2
  • Chain 'G':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfg1, d2wrfg2
  • Chain 'H':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfh1, d2wrfh2
  • Chain 'I':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/CHICKEN/POTSDAM/4705/1984(H2N2)) [TaxId:139280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67326 (Start-506)
      • conflict (119)
      • conflict (152)
      • conflict (384)
      • conflict (469)
    Domains in SCOPe 2.06: d2wrfi1, d2wrfi2
  • Heterogens: SIA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wrfA (A:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfA (A:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wrfB (B:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfB (B:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wrfC (C:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfC (C:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wrfD (D:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfD (D:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wrfE (E:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfE (E:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wrfF (F:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfF (F:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2wrfG (G:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfG (G:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2wrfH (H:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfH (H:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2wrfI (I:)
    maiiylillftavrgdqicvgyhsnnstekvdtilernvtvthaqdilekthngklckln
    gipplelgdcsiagwllgnpecdrlltvpewsyimekenprnglcypgsfndyeelkhli
    ssvthfekvkilpkdrwtqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrm
    efswtildiwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnihpltigecpkyvkserlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlekrlenl
    nkkmedgfldvwtynaellvlmenemtldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydyskyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrfI (I:)
    icvgyhsnnstekvdtilernvtvthaqdilekthngklcklngipplelgdcsiagwll
    gnpecdrlltvpewsyimekenprnglcypgsfndyeelkhlissvthfekvkilpkdrw
    tqhtttggsqgcavfdnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgayvsvgtstlnkrslpeiatrpevngqggrmefswtildiwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnihpltigecp
    kyvkserlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkest
    qkafdgitnkvnsviekmntqfeavgkefsnlekrlenlnkkmedgfldvwtynaellvl
    menemtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydysk
    yeeesk