PDB entry 2wre

View 2wre on RCSB PDB site
Description: structure of h2 japan hemagglutinin with human receptor
Class: viral protein
Keywords: viral protein, glycoprotein, envelope protein, lipoprotein
Deposited on 2009-09-01, released 2009-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2415
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/JAPAN/305+/1957(H2N2)) [TaxId:382813]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67085
      • conflict (117)
      • conflict (146)
      • conflict (169)
      • conflict (195)
      • conflict (198)
      • conflict (317)
    Domains in SCOPe 2.06: d2wrea1, d2wrea2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/JAPAN/305+/1957(H2N2)) [TaxId:382813]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67085 (Start-504)
      • conflict (117)
      • conflict (146)
      • conflict (169)
      • conflict (195)
      • conflict (198)
      • conflict (317)
    Domains in SCOPe 2.06: d2wreb1, d2wreb2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/JAPAN/305+/1957(H2N2)) [TaxId:382813]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67085
      • conflict (117)
      • conflict (146)
      • conflict (169)
      • conflict (195)
      • conflict (198)
      • conflict (317)
    Domains in SCOPe 2.06: d2wrec1, d2wrec2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wreA (A:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpidekeqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wreA (A:)
    cigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllg
    npecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwt
    qhtttggsqacavsgnpsffrnmvltkkgsnypvakgsynntsgeqmliiwgvhhpidek
    eqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfestg
    nliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpky
    vkseklvlatglrnvpqglfgaiagfieggwqgmvdgwygyhadkestqkafdgitnkvn
    sviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhds
    nvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wreB (B:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpidekeqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wreB (B:)
    dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
    llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
    rwtqhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhp
    idekeqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinf
    estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
    cpkyvkseklvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadke
    stqkafdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaell
    vlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydy
    pkyeee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wreC (C:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynn
    tsgeqmliiwgvhhpidekeqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wreC (C:)
    cigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllg
    npecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwt
    qhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpide
    keqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfest
    gnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpk
    yvkseklvlatglrnvpglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqk
    afdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlme
    nertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkye
    e