PDB entry 2wrb

View 2wrb on RCSB PDB site
Description: the structure of influenza h2 human singapore hemagglutinin with avian receptor
Class: viral protein
Keywords: glycoprotein, lipoprotein, envelope protein, viral protein
Deposited on 2009-09-01, released 2009-09-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2549
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WRB
    Domains in SCOPe 2.04: d2wrba1, d2wrba2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WRB (Start-505)
    Domains in SCOPe 2.04: d2wrbb1, d2wrbb2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WRB
    Domains in SCOPe 2.04: d2wrbc1, d2wrbc2
  • Heterogens: SIA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wrbA (A:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmidg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeees
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrbA (A:)
    igyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllgn
    pecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwtq
    htttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpndet
    eqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfestg
    nliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpky
    vkseklvlatglrnvpglfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestqka
    fdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmen
    ertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wrbB (B:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmidg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeees
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrbB (B:)
    dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
    llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
    rwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhp
    ndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinf
    estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
    cpkyvkseklvlatglrnvpglfgaiagfieggwqgmidgwygyhhsndqgsgyaadkes
    tqkafdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellv
    lmenertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydyp
    kyeees
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wrbC (C:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmidg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeees
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wrbC (C:)
    icigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwll
    gnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrw
    tqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecp
    kyvkseklvlatglrnvpglfgaiagfieggwqgmidgwygyaadkestqkafdgitnkv
    nsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhd
    snvknlydkvrmqlrdnvkel