PDB entry 2wr7

View 2wr7 on RCSB PDB site
Description: the structure of influenza h2 human singapore hemagglutinin with human receptor
Class: viral protein
Keywords: viral protein, glycoprotein, envelope protein, liproprotein
Deposited on 2009-08-30, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2417
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/SINGAPORE/1/1957(H2N2)) [TaxId:382781]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4UR26
      • conflict (165)
      • conflict (357)
    Domains in SCOPe 2.07: d2wr7a1
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/SINGAPORE/1/1957(H2N2)) [TaxId:382781]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4UR26 (Start-505)
      • conflict (165)
      • conflict (357)
    Domains in SCOPe 2.07: d2wr7b1
  • Chain 'C':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/SINGAPORE/1/1957(H2N2)) [TaxId:382781]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4UR26
      • conflict (165)
      • conflict (357)
    Domains in SCOPe 2.07: d2wr7c1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wr7A (A:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmidg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeees
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr7A (A:)
    igyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllgn
    pecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwtq
    htttggsracavsgnpsffrnmvltekgsnypvakgsynntsgeqmliiwgvhhpndete
    qrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfestgn
    liapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpkyv
    kseklvlatglrnvpglfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestqkaf
    dgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmene
    rtldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wr7B (B:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmidg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeees
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr7B (B:)
    dqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagw
    llgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkd
    rwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhp
    ndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinf
    estgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltige
    cpkyvkseklvlatglrnvpglfgaiagfieggwqgmidgwygyhhsndqgsgyaadkes
    tqkafdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellv
    lmenertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydyp
    kyeees
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wr7C (C:)
    maiiylillftavrgdqicigyhannstekvdtilernvtvthakdilekthngklckln
    gipplelgdcsiagwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhll
    ssvkhfekvkilpkdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynn
    tsgeqmliiwgvhhpndeteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrm
    efswtlldmwdtinfestgnliapeygfkiskrgssgimktegtlencetkcqtplgain
    ttlpfhnvhpltigecpkyvkseklvlatglrnvpqiesrglfgaiagfieggwqgmidg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeees
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr7C (C:)
    icigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwll
    gnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrw
    tqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhhpnd
    eteqrtlyqnvgtyvsvgtstlnkrstpdiatrpkvnglgsrmefswtlldmwdtinfes
    tgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecp
    kyvkseklvlatglrnvpglfgaiagfieggwqgmidgwygyhhsndqgsgyaadkestq
    kafdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlm
    enertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecm