PDB entry 2wr5

View 2wr5 on RCSB PDB site
Description: structure of influenza h2 duck ontario hemagglutinin
Class: viral protein
Keywords: viral protein, glycoprotein, envelope protein, liproprotein
Deposited on 2009-08-29, released 2009-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.2282
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WR5 (Start-506)
    Domains in SCOPe 2.06: d2wr5a1
  • Chain 'B':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WR5 (Start-506)
    Domains in SCOPe 2.06: d2wr5b1
  • Chain 'C':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WR5 (Start-506)
    Domains in SCOPe 2.06: d2wr5c1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wr5A (A:)
    maiiylillftvvkgdqicigyhannstekvdtilernvtvthakdilekthngklcrls
    gipplelgdcsiagwllgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhll
    tsvthfekikilprdqwtqhtttggsracavsgnpsffrnmvwltkkgsnypvakrsynn
    tsgeqmliiwgihypnddteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrm
    efswtlletwdvinfestgnliapeygfkiskrgssgimktektlencetkcqtplgain
    ttlpfhnihpltigecpkyvksdrlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviakmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr5A (A:)
    qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
    lgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhlltsvthfekikilprdq
    wtqhtttggsracavgnpsffrnmvwltkkgsnypvakrsynntsgeqmliiwgihypnd
    dteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfes
    tgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigecp
    kyvksdrlvlatglrnvpglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestq
    kafdgitnkvnsviakmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlm
    enertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypky
    eeesk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wr5B (B:)
    maiiylillftvvkgdqicigyhannstekvdtilernvtvthakdilekthngklcrls
    gipplelgdcsiagwllgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhll
    tsvthfekikilprdqwtqhtttggsracavsgnpsffrnmvwltkkgsnypvakrsynn
    tsgeqmliiwgihypnddteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrm
    efswtlletwdvinfestgnliapeygfkiskrgssgimktektlencetkcqtplgain
    ttlpfhnihpltigecpkyvksdrlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviakmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr5B (B:)
    qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
    lgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhlltsvthfekikilprdq
    wtqhtttggsracavgnpsffrnmvwltkkgsnypvakrsynntsgeqmliiwgihypnd
    dteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfes
    tgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigecp
    kyvksdrlvlatglrnvpglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestq
    kafdgitnkvnsviakmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlm
    enertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypky
    eeesk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wr5C (C:)
    maiiylillftvvkgdqicigyhannstekvdtilernvtvthakdilekthngklcrls
    gipplelgdcsiagwllgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhll
    tsvthfekikilprdqwtqhtttggsracavsgnpsffrnmvwltkkgsnypvakrsynn
    tsgeqmliiwgihypnddteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrm
    efswtlletwdvinfestgnliapeygfkiskrgssgimktektlencetkcqtplgain
    ttlpfhnihpltigecpkyvksdrlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviakmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeeesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr5C (C:)
    qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
    lgnpecdrllsvpewsyivekenptnglcypgsfndyeelkhlltsvthfekikilprdq
    wtqhtttggsracavgnpsffrnmvwltkkgsnypvakrsynntsgeqmliiwgihypnd
    dteqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfes
    tgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigecp
    kyvksdrlvlatglrnvpglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestq
    kafdgitnkvnsviakmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlm
    enertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypky
    eeesk