PDB entry 2wr1

View 2wr1 on RCSB PDB site
Description: structure of influenza h2 hemagglutinin with human receptor
Class: viral protein
Keywords: glycoprotein, lipoprotein, envelope protein, viral protein
Deposited on 2009-08-29, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1975
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WR1 (Start-508)
    Domains in SCOPe 2.07: d2wr1a1
  • Chain 'B':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WR1 (Start-508)
    Domains in SCOPe 2.07: d2wr1b1
  • Chain 'C':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WR1
    Domains in SCOPe 2.07: d2wr1c1
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wr1A (A:)
    mtitflillftivkgdqicigyhannstekvdtilernvtvthakdilekthngklcrls
    gipplelgdcsiagwllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhli
    tsvthfekvkilprdqwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynn
    tsgeqmliiwgihhpnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrm
    efswtlletwdvinfestgnliapeygfkiskrgssgimktektlencetkcqtplgain
    ttlpfhnihpltigecpkyvksdrlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeeeskaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr1A (A:)
    dqicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagw
    llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprd
    qwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynntsgeqmliiwgihhp
    nddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinf
    estgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltige
    cpkyvksdrlvlatglrnvpqglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadke
    stqkafdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaell
    vlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydy
    pkyeeeskaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wr1B (B:)
    mtitflillftivkgdqicigyhannstekvdtilernvtvthakdilekthngklcrls
    gipplelgdcsiagwllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhli
    tsvthfekvkilprdqwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynn
    tsgeqmliiwgihhpnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrm
    efswtlletwdvinfestgnliapeygfkiskrgssgimktektlencetkcqtplgain
    ttlpfhnihpltigecpkyvksdrlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeeeskaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr1B (B:)
    dqicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagw
    llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprd
    qwtqhtttggsracavldnpsffrnmvltkkgsnypiakrsynntsgeqmliiwgihhpn
    ddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfe
    stgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigec
    pkyvksdrlvlatglrnvpqiglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadke
    stqkafdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaell
    vlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydy
    pkyeeeskaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wr1C (C:)
    mtitflillftivkgdqicigyhannstekvdtilernvtvthakdilekthngklcrls
    gipplelgdcsiagwllgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhli
    tsvthfekvkilprdqwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynn
    tsgeqmliiwgihhpnddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrm
    efswtlletwdvinfestgnliapeygfkiskrgssgimktektlencetkcqtplgain
    ttlpfhnihpltigecpkyvksdrlvlatglrnvpqiesrglfgaiagfieggwqgmvdg
    wygyhhsndqgsgyaadkestqkafdgitnkvnsviekmntqfeavgkefsnlerrlenl
    nkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrmqlrdnvkelgngcfef
    yhkcddecmnsvkngtydypkyeeeskaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wr1C (C:)
    qicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagwl
    lgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprdq
    wtqhtttggsracavldnpsffrnmvltkkgsnypiakrsynntsgeqmliiwgihhpnd
    daeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinfes
    tgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltigecp
    kyvksdrlvlatglrnvpglfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestq
    kafdgitnkvnsviekmntqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlm
    enertldfhdsnvknlydkvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypky
    eeesk