PDB entry 2wqr

View 2wqr on RCSB PDB site
Description: the high resolution crystal structure of ige fc
Class: immune system
Keywords: immune system, immunoglobulin domain, glycoprotein
Deposited on 2009-08-26, released 2010-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1949
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854
      • engineered mutation (41)
      • engineered mutation (147)
    Domains in SCOPe 2.06: d2wqra1, d2wqra2, d2wqra3
  • Chain 'B':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (0-322)
      • engineered mutation (41)
      • engineered mutation (147)
    Domains in SCOPe 2.06: d2wqrb1, d2wqrb2, d2wqrb3
  • Heterogens: SO4, GOL, TRS, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqrA (A:)
    csrdftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstas
    ttqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsaylsrp
    spfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstl
    pvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtla
    cliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdefi
    cravheaaspsqtvqravsvnpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqrA (A:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsaylsrpspf
    dlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvg
    trdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacli
    qnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficra
    vheaaspsqtvqravsvnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wqrB (B:)
    csrdftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstas
    ttqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsaylsrp
    spfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstl
    pvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtla
    cliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdefi
    cravheaaspsqtvqravsvnpg