PDB entry 2wqo

View 2wqo on RCSB PDB site
Description: structure of nek2 bound to the aminopyridine cct241950
Class: transferase
Keywords: kinase, nucleus, meiosis, mitosis, cytoplasm, alternative splicing, serine/threonine-protein kinase, metal-binding, phosphoprotein, nucleotide-binding, magnesium, cell cycle, ATP-binding, transferase, coiled coil, polymorphism, cell division
Deposited on 2009-08-24, released 2009-12-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
    • PDB 2WQO (271-278)
    Domains in SCOPe 2.05: d2wqoa_
  • Heterogens: VGK, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqoA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqoA (A:)
    sraedyevlytigtgrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrelkhp
    nivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalk
    echrrlkpanvfldgkqnvklgdgtpyymspeqmnrneksdiwslgcllyelcalmppft
    afsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeilenplilehhhh
    hh