PDB entry 2wqk

View 2wqk on RCSB PDB site
Description: Crystal Structure of Sure Protein from Aquifex aeolicus
Class: hydrolase
Keywords: sure protein, putative acid phosphatase, structural genomics, 3-d structure, mixed alpha/beta protein, nppsfa, national project on protein structural and functional analyses, riken structural genomics/proteomics initiative, rsgi, hydrolase
Deposited on 2009-08-23, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: surE, aq_832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wqka_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: surE, aq_832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wqkb_
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqkA (A:)
    mptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtd
    fytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgi
    psiafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrq
    gkraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykv
    mksikyledsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqkA (A:)
    ptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtdf
    ytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgip
    siafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrqg
    kraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykvm
    ksikyled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wqkB (B:)
    mptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtd
    fytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgi
    psiafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrq
    gkraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykv
    mksikyledsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqkB (B:)
    ptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtdf
    ytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgip
    siafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrqg
    kraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykvm
    ksikyled