PDB entry 2wqi

View 2wqi on RCSB PDB site
Description: Crystal structure of the human p73 tetramerization domain
Class: transcription
Keywords: p73, p63, p53, tumor suppression, transcription factor, tetramer, oligomerization domain, DNA-binding, cooperativity, transcription, cell-cycle control, transcription regulation, apoptosis, cell cycle, development
Deposited on 2009-08-21, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wqia_
  • Chain 'B':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wqib_
  • Chain 'C':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wqic_
  • Chain 'D':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wqid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqiA (A:)
    gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqiA (A:)
    edtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wqiB (B:)
    gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqiB (B:)
    tyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wqiC (C:)
    gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqiC (C:)
    dtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wqiD (D:)
    gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqiD (D:)
    yylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr