PDB entry 2wqi
View 2wqi on RCSB PDB site
Description: Crystal structure of the human p73 tetramerization domain
Class: transcription
Keywords: p73, p63, p53, tumor suppression, transcription factor, tetramer, oligomerization domain, DNA-binding, cooperativity, transcription, cell-cycle control, transcription regulation, apoptosis, cell cycle, development
Deposited on
2009-08-21, released
2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-05-08, with a file datestamp of
2019-05-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Tumor protein p73
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2wqia_ - Chain 'B':
Compound: Tumor protein p73
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2wqib_ - Chain 'C':
Compound: Tumor protein p73
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2wqic_ - Chain 'D':
Compound: Tumor protein p73
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2wqid_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2wqiA (A:)
gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
Sequence, based on observed residues (ATOM records): (download)
>2wqiA (A:)
edtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqll
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2wqiB (B:)
gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
Sequence, based on observed residues (ATOM records): (download)
>2wqiB (B:)
tyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqll
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2wqiC (C:)
gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
Sequence, based on observed residues (ATOM records): (download)
>2wqiC (C:)
dtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllq
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2wqiD (D:)
gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
Sequence, based on observed residues (ATOM records): (download)
>2wqiD (D:)
yylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr