PDB entry 2wqg

View 2wqg on RCSB PDB site
Description: SAP domain from Tho1: L31W (fluorophore) mutant
Class: unknown function
Keywords: unknown function
Deposited on 2009-08-21, released 2010-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tho1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQG (0-1)
      • engineered mutation (30)
    • Uniprot P40040 (2-50)
    Domains in SCOPe 2.08: d2wqga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wqgA (A:)
    gsadyssltvvqlkdlltkrnlsvgglknewvqrlikddeeskgesevspq