PDB entry 2wqb

View 2wqb on RCSB PDB site
Description: Structure of the Tie2 kinase domain in complex with a thiazolopyrimidine inhibitor
Class: transferase
Keywords: phosphoprotein, kinase, receptor, oncology, ATP-binding, transferase, glycoprotein, tyrosine-protein kinase, phosphotransferase, nucleotide-binding, disease mutation, thiazolopyrimidine
Deposited on 2009-08-18, released 2009-11-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.19873
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQB
      • engineered mutation (163)
    • Uniprot Q02763
    Domains in SCOPe 2.05: d2wqba_
  • Heterogens: QQ1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqbA (A:)
    galnrkvknnpdptiypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmkey
    askddhrdfagelevlcklghhpniinllgacehrgylylaieyaphgnlldflrksrvl
    etdpafaianstastlssqqllhfaadvargmdylsqkqfihrnlaarnilvgenyvaki
    adfglsrgqevyvkktmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpyc
    gmtcaelyeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerk
    tyvnttlyekftyagidcsaeeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqbA (A:)
    ypvldwndikfqdvigeggqvlkarikkdglrmdaaikrmkelevlcklghhpniinllg
    acehrgylylaieyaphgnlldflrksrvletdpafaianstastlssqqllhfaadvar
    gmdylsqkqfihrnlaarnilvgenyvakiadfglsrgqevyvkktgrlpvrwmaiesln
    ysvyttnsdvwsygvllweivslggtpycgmtcaelyeklpqgyrlekplncddevydlm
    rqcwrekpyerpsfaqilvslnrmleerktyvnttlyekftyagidcsa