PDB entry 2wqa

View 2wqa on RCSB PDB site
Description: complex of ttr and rbp4 and oleic acid
Class: hydrolase/signaling protein
Keywords: hydrolase-signaling protein complex, thyroid hormone, retinol-binding, disease mutation, sensory transduction, vitamin a, neuropathy, amyloidosis, vision, hormone, amyloid
Deposited on 2009-08-14, released 2010-09-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.2279
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wqaa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wqab_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wqac_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wqad_
  • Chain 'E':
    Compound: retinol-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wqae_
  • Chain 'F':
    Compound: retinol-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wqaf_
  • Heterogens: SO4, OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqaA (A:)
    gsgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgl
    tteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysyst
    tavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqaA (A:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wqaB (B:)
    gsgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgl
    tteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysyst
    tavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqaB (B:)
    gkcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefveg
    iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wqaC (C:)
    gsgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgl
    tteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysyst
    tavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqaC (C:)
    gtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteee
    fvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wqaD (D:)
    gsgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgl
    tteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysyst
    tavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqaD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wqaE (E:)
    gerdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakg
    rvrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqys
    crllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqaE (E:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wqaF (F:)
    gerdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakg
    rvrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqys
    crllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqaF (F:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdg