PDB entry 2wq9

View 2wq9 on RCSB PDB site
Description: Crystal Structure of RBP4 bound to Oleic Acid
Class: signaling protein
Keywords: disease mutation, sensory transduction, signaling protein, retinol-binding, vision, vitamin a
Deposited on 2009-08-14, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wq9a_
  • Heterogens: CL, OLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wq9A (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngyc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wq9A (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscr
    llnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngyc