PDB entry 2wq5

View 2wq5 on RCSB PDB site
Description: Non-antibiotic properties of tetracyclines: structural basis for inhibition of secretory phospholipase A2.
Class: hydrolase
Keywords: hydrolase, minocycline, phospholipase, metal-binding, lipid degradation, calcium binding loop, carboxylic ester hydrolase
Deposited on 2009-08-13, released 2010-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, acidic
    Species: Naja naja [TaxId:35670]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15445 (0-118)
      • conflict (58)
      • conflict (62)
      • conflict (69)
      • conflict (80)
    Domains in SCOPe 2.08: d2wq5a_
  • Heterogens: CA, SO4, MIY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wq5A (A:)
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekiskc
wpffktysykcsqgtltckggnnacaasvcdcdrlaaicfagapyndnnynidlkarcq