PDB entry 2wq3

View 2wq3 on RCSB PDB site
Description: gcn4 leucine zipper mutant with three ixxntxx motifs coordinating chloride and nitrate
Deposited on 2009-08-12, released 2009-11-03
The last revision was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.14351
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General control protein GCN4
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-End)
      • engineered mutation (8)
      • engineered mutation (11-12)
      • engineered mutation (15)
      • engineered mutation (18-19)
      • engineered mutation (22)
      • engineered mutation (25-26)
  • Heterogens: CL, NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wq3A (A:)
    rmkqledkieentskiyhntneiarntklvger
    

    Sequence, based on observed residues (ATOM records):
    >2wq3A (A:)
    rmkqledkieentskiyhntneiarntklvge