PDB entry 2wpz

View 2wpz on RCSB PDB site
Description: gcn4 leucine zipper mutant with two vxxnxxx motifs coordinating chloride
Deposited on 2009-08-12, released 2009-11-03
The last revision was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.18126
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General control protein GCN4
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WPZ
      • engineered mutation (11)
      • engineered mutation (15)
      • engineered mutation (18)
    • Uniprot P03069 (0-End)
  • Chain 'B':
    Compound: General control protein GCN4
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WPZ
      • engineered mutation (11)
      • engineered mutation (15)
      • engineered mutation (18)
    • Uniprot P03069 (0-32)
  • Chain 'C':
    Compound: General control protein GCN4
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WPZ
      • engineered mutation (11)
      • engineered mutation (15)
      • engineered mutation (18)
    • Uniprot P03069 (0-32)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wpzA (A:)
    rmkqledkveenlskvyhnenevarlkklvger
    

    Sequence, based on observed residues (ATOM records):
    >2wpzA (A:)
    rmkqledkveenlskvyhnenevarlkklvg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2wpzB (B:)
    rmkqledkveenlskvyhnenevarlkklvger
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2wpzC (C:)
    rmkqledkveenlskvyhnenevarlkklvger