PDB entry 2wpy

View 2wpy on RCSB PDB site
Description: gcn4 leucine zipper mutant with one vxxnxxx motif coordinating chloride
Deposited on 2009-08-12, released 2009-11-03
The last revision was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21679
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General control protein GCN4
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WPY
      • engineered mutation (15)
      • engineered mutation (18)
    • Uniprot P03069 (0-End)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wpyA (A:)
rmkqledkveellskvyhnenevarlkklvger

    Sequence, based on observed residues (ATOM records):
    >2wpyA (A:)
rmkqledkveellskvyhnenevarlkklvge