PDB entry 2wpu

View 2wpu on RCSB PDB site
Description: chaperoned ruthenium metallodrugs that recognize telomeric DNA
Class: biotin binding protein
Keywords: biotin binding protein
Deposited on 2009-08-10, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.1735
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (12)
    Domains in SCOPe 2.07: d2wpua1, d2wpua2
  • Heterogens: KYT, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wpuA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wpuA (A:)
    deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vk