PDB entry 2wpq

View 2wpq on RCSB PDB site
Description: salmonella enterica sada 479-519 fused to gcn4 adaptors (sadak3, in- register fusion)
Deposited on 2009-08-09, released 2009-11-03
The last revision was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trimeric autotransporter adhesin fragment
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WPQ (70-98)
  • Uniprot Q8ZL64 (29-69)
• Chain 'B':
  Compound: trimeric autotransporter adhesin fragment
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WPQ (70-98)
  • Uniprot Q8ZL64 (29-69)
• Chain 'C':
  Compound: trimeric autotransporter adhesin fragment
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WPQ (70-98)
  • Uniprot Q8ZL64 (29-69)
• Heterogens: NO3, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >2wpqA (A:)
  mkqiedkieeilskiyhieneiarikklifdtnekvdqntadittntnsinqnttdiatn
  ttninnlsdsmkqiedkieeilskiyhieneiarikkli
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >2wpqB (B:)
  mkqiedkieeilskiyhieneiarikklifdtnekvdqntadittntnsinqnttdiatn
  ttninnlsdsmkqiedkieeilskiyhieneiarikkli
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >2wpqC (C:)
  mkqiedkieeilskiyhieneiarikklifdtnekvdqntadittntnsinqnttdiatn
  ttninnlsdsmkqiedkieeilskiyhieneiarikkli