PDB entry 2wpk

View 2wpk on RCSB PDB site
Description: factor IXa superactive triple mutant, ethylene glycol-soaked
Class: blood clotting
Keywords: blood clotting, hydrolase, hemostasis, hemophilia
Deposited on 2009-08-06, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.206
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Coagulation factor IXa light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wpke_
  • Chain 'L':
    Compound: d-phe-pro-arg-chloromethyl ketone
    Database cross-references and differences (RAF-indexed):
    • PDB 2WPK (0-2)
  • Chain 'S':
    Compound: Coagulation factor IXa heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (0-234)
      • engineered mutation (78)
      • engineered mutation (82)
      • engineered mutation (164)
    Domains in SCOPe 2.06: d2wpks_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wpkE (E:)
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr

  • Chain 'L':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wpkS (S:)
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt