PDB entry 2wpk
View 2wpk on RCSB PDB site
Description: factor IXa superactive triple mutant, ethylene glycol-soaked
Class: blood clotting
Keywords: blood clotting, hydrolase, hemostasis, hemophilia
Deposited on
2009-08-06, released
2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated
2013-10-23, with a file datestamp of
2013-10-18.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.206
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: Coagulation factor IXa light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2wpke_ - Chain 'L':
Compound: d-phe-pro-arg-chloromethyl ketone
Database cross-references and differences (RAF-indexed):
- Chain 'S':
Compound: Coagulation factor IXa heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P00740 (0-234)
- engineered mutation (78)
- engineered mutation (82)
- engineered mutation (164)
Domains in SCOPe 2.06: d2wpks_ - Heterogens: CA, EDO, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2wpkE (E:)
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr
- Chain 'L':
No sequence available.
- Chain 'S':
Sequence; same for both SEQRES and ATOM records: (download)
>2wpkS (S:)
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt