PDB entry 2wpj

View 2wpj on RCSB PDB site
Description: factor IXa superactive triple mutant, NaCl-soaked
Class: blood clotting
Keywords: blood clotting, hydrolase, hemostasis, hemophilia
Deposited on 2009-08-06, released 2009-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Coagulation factor IXa light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2wpje_
  • Chain 'L':
    Compound: d-phe-pro-arg-chloromethyl ketone
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WPJ (0-2)
  • Chain 'S':
    Compound: Coagulation factor IXa heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (0-234)
      • engineered mutation (78)
      • engineered mutation (82)
      • engineered mutation (164)
    Domains in SCOPe 2.08: d2wpjs_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wpjE (E:)
    tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr
    

  • Chain 'L':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wpjS (S:)
    vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
    tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
    kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
    cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt