PDB entry 2wph

View 2wph on RCSB PDB site
Description: factor ixa superactive triple mutant
Class: blood clotting
Keywords: serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis, hemophilia, xase-like variant, communication channel, gamma-carboxyglutamic acid, egf-like domain, disease mutation, blood clotting
Deposited on 2009-08-06, released 2009-12-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.24
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Coagulation factor IXa light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wphe_
  • Chain 'L':
    Compound: d-phe-pro-arg-chloromethyl ketone
    Database cross-references and differences (RAF-indexed):
    • PDB 2WPH (0-2)
  • Chain 'S':
    Compound: Coagulation factor IXa heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (0-234)
      • engineered mutation (78)
      • engineered mutation (82)
      • engineered mutation (164)
    Domains in SCOPe 2.02: d2wphs_
  • Heterogens: CA, 1PE, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wphE (E:)
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr

  • Chain 'L':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2wphS (S:)
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt